생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
63 kDa
종 반응성
rat, horse, mouse, human, dog, pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... STIP1(10963)
면역원
Synthetic peptide directed towards the N terminal region of human STIP1
애플리케이션
Anti-STIP1 (AB1) antibody produced in rabbit can be used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by using western blotting at a concentration of 1.25μg/ml.
생화학적/생리학적 작용
Stress-induced-phosphoprotein 1 (STIP1) also referred to as Hsp70/Hsp90-organizing protein, HOP, STI1, STI1L or P60 is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 facilitates the interaction of chaperones Hsp70 and Hsp90 for proper protein folding. Additionally, it assists as a novel biomarker for ovarian cancer. STIP1 secreted by human ovarian cancer cells binds to a bone morphogenetic protein (BMP) receptor, ALK2 (activin A receptor, type II-like kinase 2) and activates SMAD-ID3 signaling pathways. Hence, STIP1-ALK2 pathway promotes cell proliferation in ovarian cancer cells.
서열
Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
RNAi knockdown of Hop (Hsp70/Hsp90 organising protein) decreases invasion via MMP-2 down regulation.
Naomi Walsh et al.
Cancer letters, 306(2), 180-189 (2011-04-08)
We previously identified Hop as over expressed in invasive pancreatic cancer cell lines and malignant tissues of pancreatic cancer patients, suggesting an important role for Hop in the biology of invasive pancreatic cancer. Hop is a co-chaperone protein that binds
Chia-Lung Tsai et al.
Cell reports, 2(2), 283-293 (2012-08-14)
Stress-induced phosphoprotein 1 (STIP1), a cochaperone that organizes other chaperones, heat shock proteins (HSPs), was recently shown to be secreted by human ovarian cancer cells. In neuronal tissues, binding to prion protein was required for STIP1 to activate the ERK
Anna Carolina Carvalho da Fonseca et al.
Journal of neuroimmunology, 274(1-2), 71-77 (2014-07-22)
Factors released by glioma-associated microglia/macrophages (GAMs) play an important role in the growth and infiltration of tumors. We have previously demonstrated that the co-chaperone stress-inducible protein 1 (STI1) secreted by microglia promotes proliferation and migration of human glioblastoma (GBM) cell
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.