콘텐츠로 건너뛰기
Merck
모든 사진(1)

Key Documents

AV45602

Sigma-Aldrich

Anti-ESRRG antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-DKFZp781L1617, Anti-ERR3, Anti-Estrogen-related receptor γ, Anti-FLJ16023, Anti-KIAA0832, Anti-NR3B3

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

51 kDa

종 반응성

guinea pig, horse, rat, human, bovine, dog, rabbit, mouse

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ESRRG(2104)

관련 카테고리

면역원

Synthetic peptide directed towards the N terminal region of human ESRRG

애플리케이션

Anti-ESRRG antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

생화학적/생리학적 작용

Estrogen-related receptor gamma (ESRRG) is an orphan nuclear receptor that belongs to the estrogen receptor-related receptor family. ESRR family members have the same set of target genes and regulators as the estrogen receptors. ESRRG acts as a transcriptional activator of DNA cytosine-5-methyltransferases 1 and modulates cell proliferation, osteoblast differentiation and bone formation and energy metabolism in human trophoblasts. Studies indicate that this receptor mediates antidiabetic effect as it inhibits hepatic gluconeogenesis.

서열

Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Don-Kyu Kim et al.
Diabetes, 62(9), 3093-3102 (2013-06-19)
Type 2 diabetes mellitus (T2DM) is a progressive metabolic disorder with diverse pathological manifestations and is often associated with abnormal regulation of hepatic glucose production. Many nuclear receptors known to control the hepatic gluconeogenic program are potential targets for the
Byung-Chul Jeong et al.
The Journal of biological chemistry, 284(21), 14211-14218 (2009-03-28)
Estrogen receptor-related receptor gamma (ERRgamma/ERR3/NR3B3) is a member of the orphan nuclear receptor with important functions in development and homeostasis. Recently it has been reported that ERRalpha is involved in osteoblast differentiation and bone formation. In the present study we
D Poidatz et al.
Placenta, 33(9), 688-695 (2012-07-06)
Placenta growth and functions depend on correct trophoblast migration, proliferation, and differentiation. The placenta has a critical role in gas and nutrient transport. To accomplish these numerous functions, the placenta depends on a highly efficient energy metabolism control. Recent studies

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.