AV44989

Anti-SPPL2B antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-IMP4, Anti-KIAA1532, Anti-MGC111084, Anti-PSL1, Anti-Signal peptide peptidase-like 2B
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 56 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_001070706
• UniProt 수납 번호: Q8TCT7-4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SPPL2B(56928)

설명

일반 설명

Signal peptide peptidase-like 2B (SPPL2B, IMP4, PSL1), a homologue of signal peptidase, is a GxGD aspartyl protease that catalyzes regulated intra-membrane proteolysis of type II membrane-anchored signaling factors. SPPL2b catabolizes signaling substrates such as TNFα and Bri2.

특이성

Anti-SPPL2B polyclonal antibody reacts with human, mouse, rat, chicken, and bovine signal peptide peptidase-like 2B proteins.

면역원

Synthetic peptide directed towards the N terminal region of human SPPL2B

애플리케이션

Anti-SPPL2B polyclonal antibody is used to tag signal peptide peptidase-like 2B for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of signal peptide peptidase-like 2B as a cell signal regulator by mediating the intra-membrane proteolysis of membrane-anchored signaling factors.

생화학적/생리학적 작용

SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

서열

Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable