AV44817

Anti-RHOT1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO-1, Anti-Ras homolog gene family, member T1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 항체 형태: affinity isolated antibody
• Quality Level: 100
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 71 kDa
• 종 반응성: rabbit, horse, bovine, rat, human, mouse, guinea pig, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_060777
• UniProt 수납 번호: Q8IXI2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RHOT1(55288)

설명

일반 설명

Anti-RHOT1 polyclonal antibody reacts with RHOT1 in chicken, bovine, human, zebrafish, pig, rat, canine, and mouse.

Ras homolog gene family, member T1 (RHOT1, MIRO-1) is an atypical Rho GTPase involved in calcium sensitive mitochondrial trafficking. Miro interacts with the kinesin-binding proteins GRIF-1 and OIP106 forming a link between the mitochondria and the trafficking apparatus of the microtubules. Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons. Miro1 is a calcium sensor for glutamate receptor-dependent localization of mitochondria at synapses.

면역원

Synthetic peptide directed towards the N terminal region of human RHOT1

애플리케이션

Anti-RHOT1 polyclonal antibody is suitable for use in western blotting and immunohistochemical (IHC) techniques. The antibody is used as a probe to determine the role of RHOT1 in calcium-sensitive mitochondrial trafficking.

생화학적/생리학적 작용

Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

서열

Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable