AV43962

Anti-SLC25A39 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-CGI-69, Anti-CGI69, Anti-FLJ22407, Anti-Solute carrier family 25, member 39
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 39 kDa
• 종 반응성: human, horse, rat, mouse, guinea pig, rabbit, bovine, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_001137252
• UniProt 수납 번호: Q9BZJ4-2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC25A39(51629)

설명

일반 설명

Solute carrier family 25, member 39 (SLC25A39, CGI69) is a member of the SLC25 carrier family that mediates transport across the inner mitochondrial membrane. SLC25A39 may be involve in the incorporation of iron into protoporphyrin IX, an essential step in heme biosynthesis.

특이성

Anti-SLC25A39 polyclonal antibody reacts with human, mouse, rat, canine, bovine, and zebrafish solute carrier family 25, member 39 proteins.

면역원

Synthetic peptide directed towards the C terminal region of human SLC25A39

애플리케이션

Anti-SLC25A39 polyclonal antibody is used to tag solute carrier family 25, member 39 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 25, member 39 in mitochondrial transport in support of iron-dependent processes such as heme biosynthesis.

생화학적/생리학적 작용

SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

서열

Synthetic peptide located within the following region: RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable