추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
48 kDa
종 반응성
human, mouse, rat, sheep, horse, dog, bovine, rabbit
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SLC39A6(25800)
일반 설명
Solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 (SLC39A6, LIV1, ZIP6) is a mediator of zinc (Zn2+) transport and intracellular zinc homeostasis. SLC39A6/LIV1 is involves in important processes such as epithelial-to-mesenchymal transition (EMT) in human pancreatic, breast, and prostate cancer cells. SLC39A6/LIV1 has been shown to be a critical mediator responsible for HDACi-induced apoptosis.
특이성
Anti-SLC39A6 polyclonal antibody reacts with bovine, canine, human, mouse, and rat solute carrier family 39 (Zinc transporter), member 6 proteins.
면역원
Synthetic peptide directed towards the middle region of human SLC39A6
애플리케이션
Anti-SLC39A6 polyclonal antibody is used to tag solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 in intracellular zinc homeostasis, epithelial-to-mesenchymal transition (EMT) in cancer cells, and in HDACi-induced apoptosis.
생화학적/생리학적 작용
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
서열
Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.