AV43158

Anti-PRPF19 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-NMP200, Anti-PRP19, Anti-PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), Anti-PSO4, Anti-UBOX4, Anti-hPSO4
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 55 kDa
• 종 반응성: guinea pig, mouse, dog, rabbit, rat, human, horse, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_055317
• UniProt 수납 번호: Q9UMS4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PRPF19(27339)

설명

면역원

Synthetic peptide directed towards the middle region of human PRPF19

생화학적/생리학적 작용

PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair.[supplied by OMIM].

서열

Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable