AV42559

Anti-ANKRD2 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-ARPP, Anti-Ankyrin repeat domain 2 (stretch responsive muscle), Anti-MGC104314
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 49 kDa
• 종 반응성: guinea pig, horse, mouse, rabbit, human, dog, bovine, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_001123453
• UniProt 수납 번호: Q3B778
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ANKRD2(26287)

설명

일반 설명

Ankyrin repeat domain 2 (stretch responsive muscle) (Ankrd2), a MARP mechanosensing protein, is believed to be involved in skeletal muscle hypertrophy through the regulation of cell signaling and gene expression within muscle cells.

특이성

Anti-ANKRD2 antibody reacts with canine, human, mouse, and rat ankyrin repeat domain 2 (stretch responsive muscle) proteins.

면역원

Synthetic peptide directed towards the N terminal region of human ANKRD2

애플리케이션

Anti-ANKRD2 polyclonal antibody is used to tag Ankyrin repeat domain 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role Ankrd2 in muscle cell development.

생화학적/생리학적 작용

ANKRD2 may play an important role in skeletal muscle hypertrophy.

서열

Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable