AV42318

Anti-SLC20A2 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-GLVR2, Anti-Glvr-2, Anti-MLVAR, Anti-PIT-2, Anti-Solute carrier family 20 (phosphate transporter), member 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 70 kDa
• 종 반응성: guinea pig, bovine, rat, human, dog, mouse, horse, rabbit
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_006740
• UniProt 수납 번호: Q08357
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC20A2(6575)

설명

일반 설명

Solute carrier family 20 (phosphate transporter), member 2 (SLC20A2, GLVR2, MLVAR, PIT-2) is a type III Na+-dependent Pi transporter responsible for the transport of inorganic phosphate (Pi) and maintenance of Pi homeostasis that supports biological processes such as nucleic acid synthesis, tooth mineralization, skeletal development and various signaling cascades. Defective SLC20a2 is associated with idiopathic basal ganglia calcification (Fahr′s syndrome).

특이성

Anti-SLC20A2 polyclonal antibody reacts with bovine, chicken, human, mouse, rat, canine, and zebrafish solute carrier family 20 (phosphate transporter) member 2 proteins.

면역원

Synthetic peptide directed towards the N terminal region of human SLC20A2

애플리케이션

Anti-SLC20A2 polyclonal antibody is used to tag solute carrier family 20 (phosphate transporter) member 2/ gibbon ape leukemia virus 2 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 20 (phosphate transporter) member 2/gibbon ape leukemia virus 2 protein in Pi homeostasis.

서열

Synthetic peptide located within the following region: DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable