AV42101

Anti-SQLE antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FLJ30795, Anti-Squalene epoxidase
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 39 kDa
• 종 반응성: human, bovine, rabbit, mouse, sheep
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_003120
• UniProt 수납 번호: Q14534
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SQLE(6713)

설명

일반 설명

Squalene epoxidase (SQLE) is an NADPH-dependent flavoprotein monooxygenase that oxidizes squalene to 2,3,-oxidosqualene (squalene epoxide) which is the first oxygenation and rate-limiting step in sterol, ergosterol and cholesterol, biosynthesis.

특이성

Anti-SQLE polyclonal antibody reacts with human, mouse, rat, pig, zebrafish, bovine, and canine squalene epoxidases.

면역원

Synthetic peptide directed towards the C terminal region of human SQLE

애플리케이션

Anti-SQLE polyclonal antibody is used to tag squalene epoxidase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of squalene epoxidase in sterol, ergosterol and cholesterol, biosynthesis.

생화학적/생리학적 작용

Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.

서열

Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable