콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV41591

Sigma-Aldrich

Anti-VSIG4 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-V-set and immunoglobulin domain containing 4, Anti-Z39IG

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

44 kDa

종 반응성

pig, human, bovine

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... VSIG4(11326)

일반 설명

Adaptive immune response involving activated lymphocytes requires the engagement of T-cell receptors by antigenic peptide-MHC complexes (APC). B7 family members are involved in the regulation of T-cell activation by APCs. V-set and immunoglobulin domain containing 4 (VSIG4, Z39IG), a B7 family-related protein, has been identified as a negative regulator of T-cell activation. VSIG4 may play a role in inhibiting processes such as interstitial fibrosis.

특이성

Anti-VSIG4 polyclonal antibody reacts with bovine, human, mouse, and rat V-set and immunoglobulin domain containing 4 proteins.

면역원

Synthetic peptide directed towards the N terminal region of human VSIG4

애플리케이션

Anti-VSIG4 polyclonal antibody is used to tag V-set and immunoglobulin domain containing 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of V-set and immunoglobulin domain containing 4 as a negative regulator of T-cell activation during adaptive immune response.

생화학적/생리학적 작용

T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

서열

Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Qian Qiao et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 28(11), 4986-4999 (2014-08-13)
The inappropriate activation of complement may contribute to various immune diseases. The alternative pathway (AP) predominates during complement activation regardless of the initiating pathways. Hence, the main AP regulator factor H (FH) holds great potential as an attractive therapeutic intervention.
Yunmei Liao et al.
Laboratory investigation; a journal of technical methods and pathology, 94(7), 706-715 (2014-05-28)
Tumor-associated macrophages are a prominent component of lung cancer stroma and contribute to tumor progression. The protein V-set and Ig domain-containing 4 (VSIG4), a novel B7 family-related macrophage protein that has the capacity to inhibit T-cell activation, has a potential

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.