AV41591

Anti-VSIG4 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-V-set and immunoglobulin domain containing 4, Anti-Z39IG
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 44 kDa
• 종 반응성: pig, human, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_009199
• UniProt 수납 번호: Q9Y279
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... VSIG4(11326)

설명

일반 설명

Adaptive immune response involving activated lymphocytes requires the engagement of T-cell receptors by antigenic peptide-MHC complexes (APC). B7 family members are involved in the regulation of T-cell activation by APCs. V-set and immunoglobulin domain containing 4 (VSIG4, Z39IG), a B7 family-related protein, has been identified as a negative regulator of T-cell activation. VSIG4 may play a role in inhibiting processes such as interstitial fibrosis.

특이성

Anti-VSIG4 polyclonal antibody reacts with bovine, human, mouse, and rat V-set and immunoglobulin domain containing 4 proteins.

면역원

Synthetic peptide directed towards the N terminal region of human VSIG4

애플리케이션

Anti-VSIG4 polyclonal antibody is used to tag V-set and immunoglobulin domain containing 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of V-set and immunoglobulin domain containing 4 as a negative regulator of T-cell activation during adaptive immune response.

생화학적/생리학적 작용

T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

서열

Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable