콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

AV40585

Sigma-Aldrich

Anti-HNRPDL antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Heterogeneous Nuclear Ribonucleoprotein D-like

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

40 kDa

종 반응성

guinea pig, mouse, horse, rat, human, bovine, dog

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... HNRPDL(9987)

일반 설명

Heterogeneous Nuclear Ribonucleoproteins (hnRNP) are RNA binding proteins that form complexes with heterogeneous nuclear RNA (hnRNA). HnRNPs regulate pre-mRNA processing, metabolism and nuclear cytoplasmic shuttling. Specific HnRNPs have unique nucleic acid binding properties. Heterogeneous Nuclear Ribonucleoprotein D-like (JKTBP) is a DNA- and RNA-binding protein highly expressed in brain and testes tissue. JKTBP interacts with APP (β-amyloid precursor protein) creating a possible link between JKTBP and Alzheimer′s disease.

특이성

Anti-HNRPDL (JKTBP) polyclonal antibody reacts with canine, zebrafish, human, chicken, rat, bovine, and mouse heterogeneous nuclear ribonucleoprotein D-like proteins.

면역원

Synthetic peptide directed towards the middle region of human HNRPDL

애플리케이션

Anti-HNRPDL (JKTBP) polyclonal antibody is used to tag the heterogeneous nuclear ribonucleoprotein D-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of heterogeneous nuclear ribonucleoprotein D-like in specific mRNA shuttling and Alzheimer′s disease.

생화학적/생리학적 작용

HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

서열

Synthetic peptide located within the following region: TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Lorena Zubović et al.
Nucleic acids research, 40(13), 6255-6269 (2012-03-22)
Mutually exclusive splicing is a form of alternative pre-mRNA processing that consists in the use of only one of a set of two or more exons. We have investigated the mechanisms involved in this process for exon 18 of the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.