AV40136

Anti-EHF antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-9030625L19Rik, Anti-AU019492, Anti-Ets homologous factor
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 33 kDa
• 종 반응성: rat, human, mouse
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_031940
• UniProt 수납 번호: Q9NZC4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: mouse ... Ehf(13661)

설명

일반 설명

ETS transcription factors share a conserved DNA-binding "ETS" domain and include several oncoproteins that induce tumorigenesis when overexpressed. ETS homologous factor (EHF) has been found in kidney, lung and somatotroph tumors. ETS, potentially a tumor suppressor and senescence modulator, is most highly expressed in the organs known to form carcinomas upon 11p12 deletion. ETS may be a prognostic marker of carcinomas such as ovarian carcinoma.

특이성

Anti-EHF polyclonal antibody reacts with human, mouse, rat, chicken, bovine, and canine ETS homologous factor proteins.

면역원

Synthetic peptide directed towards the N terminal region of mouse Ehf

애플리케이션

Anti-EHF polyclonal antibody is used to tag ETS homologous factor proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of ETS homologous factor as a potential prognostic marker for carcinomas such as ovarian carcinoma cancer and to study gene regulation during carcinogenesis.

생화학적/생리학적 작용

Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter

서열

Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable