콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV38763

Sigma-Aldrich

Anti-POU4F1 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-POU domain, class 4, transcription factor 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

43 kDa

종 반응성

guinea pig, rat, human, mouse, rabbit

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... POU4F1(5457)

면역원

Synthetic peptide directed towards the C terminal region of human POU4F1

생화학적/생리학적 작용

POU4F1 is a neural transcription factor that is involved in the development of sensory nervous system. POU domain factors are characterized by the DNA-binding POU domain that is highly conserved. These factors bind to DNA and regulate transcription by protein-protein interactions. POU domain factors are critical regulators of early embryogenesis, development of mammalian forebrain, development and function of neuroendocrine system, regulation of gene expression in pituitary gland and hypothalamus.

서열

Synthetic peptide located within the following region: LEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Min Zou et al.
Developmental biology, 364(2), 114-127 (2012-02-14)
The sensory neurons of the dorsal root ganglia (DRG) must project accurately to their central targets to convey proprioceptive, nociceptive and mechanoreceptive information to the spinal cord. How these different sensory modalities and central connectivities are specified and coordinated still
B Andersen et al.
Endocrine reviews, 22(1), 2-35 (2001-02-13)
POU domain factors are transcriptional regulators characterized by a highly conserved DNA-binding domain referred to as the POU domain. The structure of the POU domain has been solved, facilitating the understanding of how these proteins bind to DNA and regulate
POU-domain transcription factors: pou-er-ful developmental regulators.
M G Rosenfeld
Genes & development, 5(6), 897-907 (1991-06-01)
Hans Jürgen Wester et al.
Theranostics, 5(6), 618-630 (2015-04-01)
Chemokine ligand-receptor interactions play a pivotal role in cell attraction and cellular trafficking, both in normal tissue homeostasis and in disease. In cancer, chemokine receptor-4 (CXCR4) expression is an adverse prognostic factor. Early clinical studies suggest that targeting CXCR4 with

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.