AV38128

Anti-IRF1 (AB2) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-IRF-1, Anti-Interferon regulatory factor 1, Anti-MAR
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 37 kDa
• 종 반응성: sheep, rabbit, guinea pig, rat, dog, human, mouse, bovine, horse
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_002189
• UniProt 수납 번호: P10914
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... IRF1(3659)

설명

일반 설명

Interferon regulatory factor 1 (IRF1) is a transcription factor and gene trans-activator that activates interferon-β and various other target gene expression to help regulate cell processes such as the immune response, apoptosis, and tumor suppression.

특이성

Anti-IRF1 (AB2) polyclonal antibody reacts with chicken, pig, canine, bovine, human, mouse, and rat interferon regulatory factor 1 proteins.

면역원

Synthetic peptide directed towards the N terminal region of human IRF1

애플리케이션

Anti-IRF1 (AB2) polyclonal antibody is used to tag interferon regulatory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of interferon regulatory factor 1 in gene expression of proteins involve in the immune response, apoptosis, and tumor suppression.

생화학적/생리학적 작용

IRF1 is interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppression.

서열

Synthetic peptide located within the following region: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable