추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
28 kDa
종 반응성
rat, horse, bovine, human, guinea pig, rabbit
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CLIC5(53405)
일반 설명
CLIC5 is a chloride intracellular channel protein involved in hair cell stereocilia formation. It reportedly stabilizes membrane-actin filament links at the base of stereocilia. It has a role in the growth and differentiation of C2C12 myoblasts.
Rabbit Anti-CLIC5 antibody recognizes human, mouse, rat, pig, zebrafish, chicken, canine, and bovine CLIC5.
Rabbit Anti-CLIC5 antibody recognizes human, mouse, rat, pig, zebrafish, chicken, canine, and bovine CLIC5.
면역원
Synthetic peptide directed towards the C terminal region of human CLIC5
애플리케이션
Rabbit Anti-CLIC5 antibody is suitable for western blot (0.25 μg/ml) and IHC (4-8 μg/ml) applications.
생화학적/생리학적 작용
Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.
서열
Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Fengna Li et al.
Cell biology international, 34(4), 379-384 (2010-01-09)
CLIC5 (chloride intracellular channel 5) is a CLIC (chloride intracellular channel) with various functions. Its high expression in skeletal muscle and association with actin-based cytoskeleton suggests that it may play an important role in muscle tissue. This study was conducted
Felipe T Salles et al.
Cytoskeleton (Hoboken, N.J.), 71(1), 61-78 (2013-11-29)
Chloride intracellular channel 5 protein (CLIC5) was originally isolated from microvilli in complex with actin binding proteins including ezrin, a member of the Ezrin-Radixin-Moesin (ERM) family of membrane-cytoskeletal linkers. CLIC5 concentrates at the base of hair cell stereocilia and is
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.