AV34673

Anti-CREB3L2 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-cAMP responsive element binding protein 3-like 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 57 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_919047
• UniProt 수납 번호: Q70SY1
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CREB3L2(64764)

설명

일반 설명

RCOR2 is a part of the LSD1 complex and is known to modulate ESC properties. RCOR2 also substitutes for SOX2 during somatic cell reprogramming.
Rabbit Anti-RCOR2 antibody recognizes canine, bovine, human, mouse, and rat RCOR2.

면역원

Synthetic peptide directed towards the N terminal region of human CREB3L2

애플리케이션

Rabbit Anti-RCOR2 antibody is suitable for western blot applications at 1.25 μg/ml and for IHC of praffin-embedded tissue sections at 4-8 μg/ml.

생화학적/생리학적 작용

CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).

서열

Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable