생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
66 kDa
종 반응성
human, dog, mouse, rat, guinea pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... KLHL25(64410)
일반 설명
KLHL25 is a kelch-like family member that complexes with CUL3 to form E3 ubiquitin ligase complex. This complex is known to target hypophosphorylated 4E-BP1.
Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.
Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.
면역원
Synthetic peptide directed towards the N terminal region of human KLHL25
애플리케이션
Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 μg/ml.
생화학적/생리학적 작용
KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
서열
Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Akiko Yanagiya et al.
Molecular cell, 46(6), 847-858 (2012-05-15)
Translational control of gene expression plays a key role in many biological processes. Consequently, the activity of the translation apparatus is under tight homeostatic control. eIF4E, the mRNA 5' cap-binding protein, facilitates cap-dependent translation and is a major target for
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.