생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
39 kDa
종 반응성
horse, human, dog
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... SMARCAD1(56916)
일반 설명
SMARCAD1 is a SWI/SNF-related helicase that regulates heterochromatin organization and histone deacteylation. Studies in humans have reported that SMARCAD1 can enhance DNA end resection. SMARCAD1 mutation has been linked to autosomal-dominant adermatoglyphia.
Rabbit Anti-SMARCAD1 recognizes bovine, human, mouse, rat, and canine SMARCAD1.
Rabbit Anti-SMARCAD1 recognizes bovine, human, mouse, rat, and canine SMARCAD1.
면역원
Synthetic peptide directed towards the N terminal region of human SMARCAD1
애플리케이션
Rabbit Anti-SMARCAD1 is suitable for western blot applications at a concentration of 1 μg/ml.
생화학적/생리학적 작용
SMARCAD1 belongs to the SNF2/RAD54 helicase family. It contains 2 CUE domains, 1 helicase ATP-binding domain, and 1 helicase C-terminal domain. It is a probable ATP-dependent DNA helicase.
서열
Synthetic peptide located within the following region: RANTPDSDITEKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSED
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Janna Nousbeck et al.
American journal of human genetics, 89(2), 302-307 (2011-08-09)
Monogenic disorders offer unique opportunities for researchers to shed light upon fundamental physiological processes in humans. We investigated a large family affected with autosomal-dominant adermatoglyphia (absence of fingerprints) also known as the "immigration delay disease." Using linkage and haplotype analyses
Thomas Costelloe et al.
Nature, 489(7417), 581-584 (2012-09-11)
Several homology-dependent pathways can repair potentially lethal DNA double-strand breaks (DSBs). The first step common to all homologous recombination reactions is the 5'-3' degradation of DSB ends that yields the 3' single-stranded DNA required for the loading of checkpoint and
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.