AV34429

Anti-USF1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Upstream transcription factor 1
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 클론: polyclonal
• application: WB
• 종 반응성: bovine, rat, human, dog, rabbit, horse, mouse, guinea pig
• 기술: western blot: suitable
• citations: 3

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 34 kDa
• 종 반응성: bovine, rat, human, dog, rabbit, horse, mouse, guinea pig
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_009053
• UniProt 수납 번호: P22415
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... USF1(7391)

설명

일반 설명

USF1 is a leucine zipper transcription factor that forms a part of complexes that interact with fatty acid synthase (FAS) insulin response sequence (IRS). Valproic acid (VPA) is known to inhibit adipogenesis by repressing USF1-induced synthesis of fatty acids. Studies have reported that USF1 gene is associated with familial combined hyperlipidemia (FCHL).
Rabbit Anti-USF1 (AB2) antibody recognizes human, mouse, rat, rabbit, canine, chicken, pig, and bovine USF1.

면역원

Synthetic peptide directed towards the N terminal region of human USF1

애플리케이션

Rabbit Anti-USF1 (AB2) can be used for western blot applications at 1.25 μg/ml.

생화학적/생리학적 작용

USF1 encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).

서열

Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable