추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
51 kDa
종 반응성
guinea pig, human, dog, bovine, rat, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CORO1A(11151)
일반 설명
CORO1A is a WD-repeat protein that has been implicated in Mycobacterium leprae infection. Studies have reported that CORO1A localizes on the membrane of phagosomes that contain M. leprae, where Toll-like receptor (TLR) 2 is also present. CORO1A suppresses TLR-mediated signaling in human macrophages.
Rabbit Anti-CORO1A recognizes bovine, rat, rabbit, mouse, human, and canine CORO1A.
Rabbit Anti-CORO1A recognizes bovine, rat, rabbit, mouse, human, and canine CORO1A.
면역원
Synthetic peptide directed towards the C terminal region of human CORO1A
애플리케이션
Rabbit Anti-CORO1A can be used for western blot applications at a concentration of 1.25 μg/ml.
생화학적/생리학적 작용
CORO1A forms homodimers. It plays a role in the cross-linking of F-actin in the cell.
서열
Synthetic peptide located within the following region: TGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Koichi Suzuki et al.
Acta histochemica et cytochemica, 39(4), 107-112 (2007-03-01)
Mycobacteria have acquired an intracellular lifestyle within the macrophage, which is best exemplified by the enlarged infected histiocytes seen in lepromatous leprosy. To survive within the cell, mycobacteria must escape intracellular bactericidal mechanisms. In a study of Mycobacterium bovis Bacille
K Tanigawa et al.
Clinical and experimental immunology, 156(3), 495-501 (2009-05-15)
Mycobacterium leprae is an intracellular pathogen that survives within the phagosome of host macrophages. Several host factors are involved in producing tolerance, while others are responsible for killing the mycobacterium. Tryptophan aspartate-containing coat protein (TACO; also known as CORO1A or
M M-G Sun et al.
Osteoarthritis and cartilage, 22(7), 996-1006 (2014-05-24)
Activation of the Liver X Receptor (LXR) has recently been identified as a therapeutic strategy for osteoarthritis (OA). Human OA articular cartilage explants show decreased LXR expression, and LXRβ-null mice display OA-like symptoms. LXR agonist administration to OA articular cartilage
Zuoren Yu et al.
Oncotarget, 5(4), 1083-1090 (2014-03-25)
The serine threonine kinase Akt1 has been implicated in the control of cellular metabolism, survival and growth. Herein, disruption of the ubiquitously expressed member of the Akt family of genes, Akt1, in the mouse, demonstrates a requirement for Akt1 in
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.