추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
41 kDa
종 반응성
human, bovine, guinea pig, rat
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ACAT2(39)
일반 설명
ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis. It has also been implicated in the inhibition of apoB secretion in liver cells.
Rabbit Anti-ACAT2 (AB1) antibody recognizes bovine, human, mouse, and rat ACAT2.
Rabbit Anti-ACAT2 (AB1) antibody recognizes bovine, human, mouse, and rat ACAT2.
면역원
Synthetic peptide directed towards the middle region of human ACAT2
애플리케이션
Rabbit Anti-ACAT2 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.
생화학적/생리학적 작용
Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
서열
Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
L J Wilcox et al.
Journal of lipid research, 42(5), 725-734 (2001-05-16)
The citrus flavonoids, naringenin and hesperetin, lower plasma cholesterol in vivo. However, the underlying mechanisms are not fully understood. The ability of these flavonoids to modulate apolipoprotein B (apoB) secretion and cellular cholesterol homeostasis was determined in the human hepatoma
Paolo Parini et al.
Circulation, 110(14), 2017-2023 (2004-09-29)
Two acyl-coenzyme A:cholesterol acyltransferase (ACAT) genes, ACAT1 and ACAT2, have been identified that encode 2 proteins responsible for intracellular cholesterol esterification. In this study, immunohistology was used to establish their cellular localization in human liver biopsies. ACAT2 protein expression was
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.