생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
30 kDa
종 반응성
horse, dog, rabbit, pig, human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CDX4(1046)
일반 설명
Caudal related homeobox (Cdx) genes are known to modulate axial elongation and patterning in many vertebrate embryos. Cdx4 regulates the ontogenesis of placental labyrinth in mice. Furthermore, Cdx4 is known to dysregulate Hox gene expression which causes acute myeloid leukemia in mouse models.
Rabbit Anti-CDX4 antibody recognizes rat, mouse, bovine, and human CDX4.
Rabbit Anti-CDX4 antibody recognizes rat, mouse, bovine, and human CDX4.
면역원
Synthetic peptide directed towards the C terminal region of human CDX4
애플리케이션
Rabbit Anti-CDX4 (AB1) antibody can be used for western blot applications at a concentration of 2.5 μg/ml.
생화학적/생리학적 작용
CDX are homeodomain transcription factors related to the Drosophila caudal gene. The vertebrate CDX have been implicated in the development of the posterior embryo. Several signaling molecules, notably retinoic acid (RA) and members of the Wnt (wingless) and fibroblast growth factor (FGF) families, are also implicated in patterning of the posterior vertebrate embryo. CDX family is the target of Wnt, RA and FGF signaling, suggesting that CDX factors act to convey the activity of these signaling molecules to Hox genes.
서열
Synthetic peptide located within the following region: KKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Johan van Nes et al.
Development (Cambridge, England), 133(3), 419-428 (2006-01-07)
Caudal related homeobox (Cdx) genes have so far been shown to be important for embryonic axial elongation and patterning in several vertebrate species. We have generated a targeted mutation of mouse Cdx4, the third member of this family of transcription
Dimple Bansal et al.
Proceedings of the National Academy of Sciences of the United States of America, 103(45), 16924-16929 (2006-10-28)
HOX genes have emerged as critical effectors of leukemogenesis, but the mechanisms that regulate their expression in leukemia are not well understood. Recent data suggest that the caudal homeobox transcription factors CDX1, CDX2, and CDX4, developmental regulators of HOX gene
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.