AV32759

Anti-HMG20A (AB2) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FLJ10739, Anti-HMGX1, Anti-High-mobility group 20A
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 클론: polyclonal
• application: WB
• 종 반응성: mouse, rat, dog, guinea pig, horse, human
• 기술: western blot: suitable
• citations: 2

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 40 kDa
• 종 반응성: mouse, rat, dog, guinea pig, horse, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_060670
• UniProt 수납 번호: Q9NP66
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... HMG20A(10363)

설명

일반 설명

HMG20A is a homeobox gene that is expressed ubiquitously. Studies in CHO-K1 cells have reported that it interacts with the poxvirus protein, CP77, and modulates its dissociation from the genome of vaccinia virus.
Rabbit Anti-HMG20A (AB2) antibody recognizes bovine, human, mouse, rat, and canine HMG20A.

면역원

Synthetic peptide directed towards the middle region of human HMG20A

애플리케이션

Rabbit Anti-HMG20A (AB2) antibody can be used for western blot applications at 1.25 μg/ml.

생화학적/생리학적 작용

HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4

서열

Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable