추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
55 kDa
종 반응성
rat, horse, dog, bovine, human, rabbit, mouse, guinea pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... NFIA(4774)
일반 설명
NFIA is a transcription factor that regulates gliogenesis during spinal cord development. Haploinsufficeincy of NFIA has been linked to urinary tract defects and CNS malformation syndrome.
Rabbit Anti-NFIA recognizes chicken, canine, human, mouse, rat, zebrafish, and bovine NFIA.
Rabbit Anti-NFIA recognizes chicken, canine, human, mouse, rat, zebrafish, and bovine NFIA.
면역원
Synthetic peptide directed towards the middle region of human NFIA
애플리케이션
Rabbit Anti-NFIA can be used for western blot applications at a concentration of 2μg/ml.
생화학적/생리학적 작용
Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.[supplied by OMIM].
서열
Synthetic peptide located within the following region: QHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Neuron, 52(6), 953-968 (2006-12-21)
The mechanisms controlling the transition from neurogenesis to gliogenesis in the vertebrate CNS are incompletely understood. We identified a family of transcription factors, called NFI genes, which are induced throughout the spinal cord ventricular zone (VZ) concomitantly with the induction
PLoS genetics, 3(5), e80-e80 (2007-05-29)
Complex central nervous system (CNS) malformations frequently coexist with other developmental abnormalities, but whether the associated defects share a common genetic basis is often unclear. We describe five individuals who share phenotypically related CNS malformations and in some cases urinary
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.