AV32479

Anti-NCOR1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Nuclear receptor co-repressor 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 270 kDa
• 종 반응성: mouse, dog, human, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_006302
• UniProt 수납 번호: Q60974
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NCOR1(9611)

설명

일반 설명

Nuclear receptor co-repressor 1/thyroid-hormone- and retinoic-acid-receptor-associated co-repressor 1 (NCOR1, TRAC-1) is a transcriptional coregulatory protein that recruits histone deacetylases to DNA promoter regions and assists nuclear receptors in the down regulation of RNA expression. NCOR1 controls thyroid hormone sensitivity and the set point of the hypothalamic-pituitary-thyroid axis. NCOR1 plays an adaptive role in muscle physiology.

Rabbit polyclonal anti-NCOR1 antibody reacts with human, canine, and mouse nuclear receptor co-repressor 1 transcriptional coregulatory proteins.

면역원

Synthetic peptide directed towards the N terminal region of human NCOR1

애플리케이션

Rabbit Anti-NCOR1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Rabbit polyclonal anti-NCOR1 antibody is used to tag nuclear receptor co-repressor 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of nuclear receptor co-repressor 1 in the hypothalamic-pituitary-thyroid axis regulation and muscle physiology.

생화학적/생리학적 작용

NCOR1 mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p.

서열

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable