AV32135

Anti-MyF6 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-MRF4, Anti-Myogenic factor 6 (herculin)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 27 kDa
• 종 반응성: mouse, guinea pig, sheep, rabbit, horse, rat, goat, bovine, dog, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_002460
• UniProt 수납 번호: P23409
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... MYF6(4618)

설명

일반 설명

MyF6 is a possible helix-loop-helix protein that may be involved in muscle differentiation. It is known to have conserved DNA binding and dimerization domains.
Rabbit Anti-MyF6 antibody recognizes canine, human, mouse, rat, bovine, zebrafish, pig, and chicken MyF6.

면역원

Synthetic peptide directed towards the N terminal region of human MYF6

애플리케이션

Rabbit Anti-MyF6 antibody can be used for western blot applications at a concentration of 1μg/ml.

생화학적/생리학적 작용

MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.

서열

Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable