AV31477

Anti-SLC30A9 (AB1) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Solute carrier family 30 (Zinc transporter), member 9
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 63 kDa
• 종 반응성: rat, human, horse, guinea pig, rabbit, bovine, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_006336
• UniProt 수납 번호: Q6PML9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC30A9(10463)

설명

일반 설명

SLC30A9 is a member of the solute carrier family that may function as a zinc transporter.
Rabbit Anti-SLC30A9 (AB1) antibody recognizes rat, human, canine, mouse, pig, bovine, and zebrafish SLC30A9.

The previously assigned protein identifier Q9Y6R2 has been merged into Q6PML9. Full details can be found on the UniProt database.

면역원

Synthetic peptide directed towards the N terminal region of human SLC30A9

애플리케이션

Rabbit Anti-SLC30A9 (AB1) antibody is suitable for use in western blot assays at a concentration of 0.5-2.0μg/ml. The antibody can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.

생화학적/생리학적 작용

The gene corresponding to embryonic lung protein [also known as Solute carrier family 30 (Zinc transporter), member 9, SLC30A9], is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.

서열

Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable