AV31366

Anti-ATF1 (AB2) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Activating transcription factor 1, Anti-EWS-ATF1, Anti-FUS/ATF-1, Anti-TREB36
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: IHC; WB
• 클론: polyclonal
• 종 반응성: rabbit, horse, dog, rat, guinea pig, human
• citations: 2
• 기술: immunohistochemistry: suitable; western blot: suitable

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 29 kDa
• 종 반응성: rabbit, horse, dog, rat, guinea pig, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_005162
• UniProt 수납 번호: P18846
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ATF1(466)

설명

일반 설명

ATF1 is a member of the AMP response element-binding protein/activating transcription factor (CREB/ATF) that associates with BRCA1. ATF1 target genes have been implicated in mediating transcriptional response to DNA damage. Moreover, studies have reported that phosphorylation of ATF1 is needed for growth factor-induced expression of c-jun.
Rabbit Anti-ATF1 (AB2) antibody recognizes rat, mouse, zebrafish, bovine, and human ATF1.

면역원

Synthetic peptide directed towards the middle region of human ATF1

애플리케이션

Rabbit Anti-ATF1 (AB2) antibody can be used for western blotting (0.5μg/ml) applications.

생화학적/생리학적 작용

ATF1 binds the cAMP response element (CRE) (consensus: 5′-GTGACGT [AC] [AG]-3′), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes.

서열

Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable