생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
99 kDa
종 반응성
rabbit, mouse, horse, bovine, rat, guinea pig, human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... GRIA2(2891)
면역원
Synthetic peptide directed towards the N terminal region of human GRIA2
애플리케이션
Anti-GRIA2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
생화학적/생리학적 작용
GRIA2 or glutamate receptor 2 (GluR2) inhibits the influx of calcium through AMPA-receptor complexes. Mutations in GRIA2 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.
서열
Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Andy N Mead et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 23(29), 9500-9507 (2003-10-24)
Presence of the glutamate receptor 2 (GluR2) subunit prevents calcium influx through AMPA-receptor complexes; deletion of this subunit results in enhanced hippocampal long-term potentiation. We investigated whether mice lacking the GluR2 subunit [gria2 knock-out (KO) mice] displayed impairments in learning
Alberto Chiesa et al.
European archives of psychiatry and clinical neuroscience, 262(4), 305-311 (2011-11-08)
The present study is aimed to exploring whether some single nucleotide polymorphisms (SNPs) within GRIA1, GRIA2 and GRIA4 could be associated with major depressive disorder (MDD) and whether they could predict clinical outcomes in Korean in-patients, respectively, treated with antidepressants.
Junyu Xu et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(46), 15415-15424 (2014-11-14)
In the CNS, synapse formation and maturation play crucial roles in the construction and consolidation of neuronal circuits. Neurexin and neuroligin localize on the opposite sides of synaptic membrane and interact with each other to promote the assembly and specialization
Sarah L Ferri et al.
Hormones and behavior, 66(2), 409-420 (2014-07-06)
Ovarian hormones act in multiple brain regions to modulate specific behaviors and emotional states. For example, ovarian hormones promote female sexual receptivity in the hypothalamic ventromedial nucleus (VMH) and modulate anxiety in the amygdala. Hormone-induced changes within the VMH include
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.