콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV100775

Sigma-Aldrich

Anti-TCF4 (AB1) antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-Transcription factor 4

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

71 kDa

종 반응성

mouse, horse, guinea pig, human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... TCF4(6925)

일반 설명

TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.

면역원

Synthetic peptide directed towards the N terminal region of human TCF4

애플리케이션

Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

생화학적/생리학적 작용

TCF-4 mediates the transformation of epithelial cells of colon in the absence of APC gene expression. The expression of TCF-4 is required to establish the proliferative progenitors to form the crypts of embryonic small intestine. TCF-4 collaborates with b-catenin to regulate the colorectal transformation process. Lack of TCF-4 expression results in developmental delay and intellectual disability termed as Pitt-Hopkins syndrome.

서열

Synthetic peptide located within the following region: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

J David Sweatt
Experimental & molecular medicine, 45, e21-e21 (2013-05-04)
TCF4 (transcription factor 4; E2-2, ITF2) is a transcription factor that when haplo-insufficient causes Pitt-Hopkins Syndrome (PTHS), an autism-spectrum disorder that is associated with pervasive developmental delay and severe intellectual disability. The TCF4 gene is also a risk factor with
Marc van de Wetering et al.
Cell, 111(2), 241-250 (2002-11-01)
The transactivation of TCF target genes induced by Wnt pathway mutations constitutes the primary transforming event in colorectal cancer (CRC). We show that disruption of beta-catenin/TCF-4 activity in CRC cells induces a rapid G1 arrest and blocks a genetic program
V Korinek et al.
Nature genetics, 19(4), 379-383 (1998-08-11)
Mutations of the genes encoding APC or beta-catenin in colon carcinoma induce the constitutive formation of nuclear beta-catenin/Tcf-4 complexes, resulting in activated transcription of Tcf target genes. To study the physiological role of Tcf-4 (which is encoded by the Tcf7/2

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.