AV09002

Anti-SerPINH1 antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 46 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunoprecipitation (IP): suitable; western blot: suitable
• NCBI 수납 번호: NP_001226
• UniProt 수납 번호: P50454
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SERPINH1(871)

설명

면역원

Synthetic peptide directed towards the C terminal region of human SERPINH1

애플리케이션

Anti- SerPINH1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

생화학적/생리학적 작용

SerPINH1 (Hsp47) is a molecular chaperone that regulates protein folding of type I and type IV procollagen in the endoplasmic reticulum. The activity of Hsp47 is critical for the development of well-organized cartilage and formation of normal endochondral bone.

서열

Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable