콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV02055

Sigma-Aldrich

Anti-TP53 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Tumor protein p53 (Li-Fraumeni syndrome)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

44 kDa

종 반응성

human

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... TP53(7157)

면역원

Synthetic peptide directed towards the C terminal region of human TP53

애플리케이션

Anti-TP53 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

생화학적/생리학적 작용

TP53 is a tumor suppressor protein essential for protection against development of cancer. Mutations in the TP53 gene or alterations in function of the protein result in predisposition to colorectal cancer, gastric and esophageal cancers. TP53 also acts as a transcription factor and maintains the genetic stability preventing malignant transformation.

서열

Synthetic peptide located within the following region: RELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPD

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Marilanda Ferreira Bellini et al.
Journal of biomedicine & biotechnology, 2012, 891961-891961 (2012-08-25)
TP53 genes is one of more important tumor suppressor gene, which acts as a potent transcription factor with fundamental role in the maintenance of genetic stability. The development of esophageal and gastric cancers is a multistep process resulting in successive
Shingo Miyawaki et al.
Nature communications, 7, 11471-11471 (2016-05-11)
The naked mole-rat (NMR, Heterocephalus glaber), which is the longest-lived rodent species, exhibits extraordinary resistance to cancer. Here we report that NMR somatic cells exhibit a unique tumour-suppressor response to reprogramming induction. In this study, we generate NMR-induced pluripotent stem
A Naccarati et al.
Mutagenesis, 27(2), 211-218 (2012-02-02)
A functionally normal TP53 is essential to protect organisms from developing cancer. Somatic mutations in the gene represent one of the highest recurring perturbations in human tumours, including colorectal cancer (CRC). However, the variegated phenotype of wide spectrum of somatic
Wei Min et al.
The American journal of Chinese medicine, 42(3), 709-727 (2014-05-30)
Ultraviolet A (UVA) radiation contributes to skin photoaging. Baicalin, a plant-derived flavonoid, effectively absorbs UV rays and has been shown to have anti-oxidant and anti-inflammatory properties that may delay the photoaging process. In the current study, cultured human skin fibroblasts
Jia-Ming Xie et al.
Cancer research, 74(18), 5127-5138 (2014-08-03)
The p53-induced glycolysis and apoptosis regulator (TIGAR) inhibits glycolysis, resulting in higher intracellular NADPH, lower reactive oxygen species (ROS) and autophagy activity. In this study, we investigated whether TIGAR might exert dual impacts on cancer cell survival based on its

문서

p53 regulates gene expression, cell cycle control and functions as a tumor suppressor. Inactivation of p53 is closely tied to cancer development.

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.