APREST95500

PrEST Antigen MAP4K5

Prestige Antibodies^® Powered by Atlas Antibodies, buffered aqueous solution

• 동의어(들): GCKR, KHS, KHS1
• UNSPSC 코드: 12352203

속성

• 재조합: expressed in E. coli
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 분석: >80% (SDS-PAGE)
• 양식: buffered aqueous solution
• 분자량: predicted mol wt 23 kDa
• 정제법: immobilized metal affinity chromatography (IMAC)
• 농도: ≥0.5 mg/mL
• 서열 기록: WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI
• Ensembl | 인체 수납 번호: ENSG00000012983
• UniProt 수납 번호: Q9Y4K4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... MAP4K5(11183)

설명

일반 설명

N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

애플리케이션

Suitable as a blocking agent and positive assay control using corresponding antibodies.

결합

Corresponding Antibodies HPA078030

물리적 형태

Solution in 1 M urea-PBS, pH 7.4

저장 및 안정성

Store at -20°C. Avoid repeated freeze/thaw cycles.

기타 정보

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable