콘텐츠로 건너뛰기
Merck
모든 사진(7)

Key Documents

AMAB91168

Sigma-Aldrich

Monoclonal Anti-LAMP1 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL3482, purified immunoglobulin, buffered aqueous glycerol solution

동의어(들):

Anti-CD107a

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.43

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

CL3482, monoclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

기술

immunoblotting: 1 μg/mL
immunohistochemistry: 1:10000- 1:20000

동형

IgG1

면역원 서열

NFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDA

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... LAMP1(3916)

일반 설명

The gene LAMP1 (lysosomal-associated membrane protein 1) encodes a type I transmembrane protein that has a short cytoplasmic tail containing a lysosome-targeting signal of GYQTI(382)-COOH. The gene is mapped to human chromosome 13q34.

면역원

lysosomal-associated membrane protein 1

애플리케이션

All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

The gene LAMP1 (lysosomal associated membrane protein 1) encodes a membrane glycoprotein that functions as an intracellular receptor. It is found to be expressed in the cytoplasm of several types of tumor cells and may be involved in tumor invasion. Lamp1 is crucial for perforin trafficking to the lytic granules and motility of these lytic granules. Its knockdown leads to inhibition of cytotoxicity of human natural killer cells.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST93498

물리적 형태

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Acidic pH-Induced Conformations and LAMP1 Binding of the Lassa Virus Glycoprotein Spike.
Li S
PLoS Pathogens, 12, e1005418-e1005418 (2016)
Monosomy and ring chromosome 13 in a thyroid nodular goiter-do we underestimate its relevance in benign thyroid lesions?
Sendt W
Cancer Genetics, 205, 128-130 (2012)
LAMP1/CD107a is required for efficient perforin delivery to lytic granules and NK-cell cytotoxicity.
Krzewski K
Blood, 121, 4672-4683 (2013)
Expression of the lysosomal-associated membrane protein-1 (LAMP-1) in astrocytomas.
Jensen SS
International Journal of Clinical and Experimental Pathology, 6, 1294-1305 (2013)
Kenji Akasaki et al.
Journal of biochemistry, 156(1), 39-49 (2014-04-04)
Lysosome-associated membrane protein-1 (LAMP-1) is a type I transmembrane protein with a short cytoplasmic tail that possesses a lysosome-targeting signal of GYQTI(382)-COOH. Wild-type (WT)-LAMP-1 was exclusively localized in high density lysosomes, and efficiency of LAMP-1's transport to lysosomes depends on

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.