추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
CL2754, monoclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
mouse, human, rat
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 1 μg/mL
immunohistochemistry: 1:5000- 1:10000
동형
IgG2b
면역원 서열
PSISEEERKYIEDAIGESAKLMNPLTKFSTP
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... VGLUT1(57030)
일반 설명
Vesicular glutamate transporter 1 (VGLUT1), also called as solute carrier family 17 member 7
(SLC17A7), is encoded by the gene mapped to human chromosome 19q13, a region associated with schizophrenia. VGLUT1 is specifically expressed in neuronal cells in the brain and at higher level in neuron-enriched regions such as the amygdala and hippocampus. Glia-enriched areas such as the corpus callosum also show moderate level of expression and substantia nigra, subthalamic nuclei and thalamus show low level expression. VGLUT1 is characterized with a conserved C-terminal dileucine-like motif and two polyproline domains distal to C- terminal end, including one that binds to endocytic BAR (Bin/Amphiphysin/Rvs) domain protein, endophilin.
(SLC17A7), is encoded by the gene mapped to human chromosome 19q13, a region associated with schizophrenia. VGLUT1 is specifically expressed in neuronal cells in the brain and at higher level in neuron-enriched regions such as the amygdala and hippocampus. Glia-enriched areas such as the corpus callosum also show moderate level of expression and substantia nigra, subthalamic nuclei and thalamus show low level expression. VGLUT1 is characterized with a conserved C-terminal dileucine-like motif and two polyproline domains distal to C- terminal end, including one that binds to endocytic BAR (Bin/Amphiphysin/Rvs) domain protein, endophilin.
면역원
solute carrier family 17 member 7
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
Vesicular glutamate transporter 1 (VGLUT1) plays a vital role as an vesicular glutamate transporter in glutamatergic neurons. VGLUT1 expression in the prefrontal cortex, functions as a potential neurochemical marker of dementia in Alzheimer disease (AD) and antidepressant activity.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST70070
물리적 형태
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Assignment of SLC17A6 (alias DNPI), the gene encoding brain/pancreatic islet-type Na+-dependent inorganic phosphate cotransporter to human chromosome 11p14. 3.
Aihara Y, et al.
Cytogenetic and genome research, 92(1-2), 167-169 (2001)
Lentiviral delivery of a vesicular glutamate transporter 1 (VGLUT1)-targeting short hairpin RNA vector into the mouse hippocampus impairs cognition.
King M V, et al.
Neuropsychopharmacology, 39(2), 464?476-464?476 (2014)
Loss of VGLUT1 and VGLUT2 in the prefrontal cortex is correlated with cognitive decline in Alzheimer disease.
Kashani A, et al.
Neurobiology of Aging, 29(11), 1619-1630 (2008)
Molecular and functional analysis of a novel neuronal vesicular glutamate transporter.
Bai L, et al.
The Journal of Biological Chemistry, 276(39), 36764-36769 (2001)
Selective cortical VGLUT1 increase as a marker for antidepressant activity.
Moutsimilli L, et al.
Neuropharmacology, 49(6), 890-900 (2005)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.