생물학적 소스
mouse
Quality Level
항체 형태
purified antibody
항체 생산 유형
primary antibodies
클론
29A3, monoclonal
종 반응성
human
제조업체/상표
Chemicon®
기술
immunocytochemistry: suitable
immunohistochemistry: suitable
western blot: suitable
동형
IgG1
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
타겟 번역 후 변형
unmodified
유전자 정보
human ... ITGA3(3675)
일반 설명
MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.
특이성
Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.
SPECIES REACTIVITIES:
Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
SPECIES REACTIVITIES:
Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
면역원
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY
애플리케이션
Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot
Immunocytochemistry
Immunohistochemistry (Frozen Sections)
Optimal working dilutions must be determined by the end user.
Immunocytochemistry
Immunohistochemistry (Frozen Sections)
Optimal working dilutions must be determined by the end user.
물리적 형태
Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.
기타 정보
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
법적 정보
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Canine malignant melanoma alpha-3 integrin binding peptides.
Aina, OH; Maeda, Y; Harrison, M; Zwingenberger, AL; Walker, NJ; Lam, KS; Kent, MS
Veterinary Immunology and Immunopathology null
Frédéric Dallaire et al.
Journal of virology, 83(11), 5329-5338 (2009-03-20)
The human adenovirus E4orf6 and E1B55K proteins promote viral replication by targeting several cellular proteins for degradation. The E4orf6 product has been shown by our group and others to form an E3 ubiquitin ligase complex that contains elongins B and
Frédéric Dallaire et al.
Journal of virology, 83(23), 12172-12184 (2009-09-18)
It has been known for some time that the human adenovirus serotype 5 (Ad5) E4orf6 and E1B55K proteins work in concert to degrade p53 and to regulate selective export of late viral mRNAs during productive infection. Both of these functions
Jake D Howden et al.
BMC biology, 19(1), 130-130 (2021-06-24)
Keratinocytes form the main protective barrier in the skin to separate the underlying tissue from the external environment. In order to maintain this barrier, keratinocytes form robust junctions between neighbouring cells as well as with the underlying extracellular matrix. Cell-cell
Role of integrins in the assembly and function of hensin in intercalated cells.
Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
Journal of the American Society of Nephrology null
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.