374090

Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

liquid, Calbiochem^®

• 동의어(들): Anti-HO-1, Anti-Hsp32
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 항체 형태: purified antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: liquid
• 포함: ≤0.1% sodium azide as preservative
• 종 반응성: human, hamster, monkey, mouse, rat, canine
• 제조업체/상표: Calbiochem^®
• 저장 조건: OK to freeze; avoid repeated freeze/thaw cycles
• 동형: IgG
• 배송 상태: ambient
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... HMOX1(3162)

설명

일반 설명

Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.

Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.

Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.

면역원

Human

a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

애플리케이션

Immunoblotting (1:1000, chemiluminescence)

Immunoprecipitation (1:100)

경고

Toxicity: Standard Handling (A)

물리적 형태

In PBS, 50% glycerol, pH 7.2.

재구성

Following initial thaw, aliquot and freeze (-20°C).

기타 정보

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.

Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

법적 정보

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1