219482

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable

Caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58).

• 동의어(들): Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
• 실험식(Hill 표기법): C₂₂₈H₃₃₅N₆₁O₄₉S
• Molecular Weight: 4746.54
• UNSPSC 코드: 12352202
• NACRES: NA.77

속성

• Quality Level: 100
• 분석: ≥95% (HPLC)
• 양식: lyophilized solid
• 제조업체/상표: Calbiochem^®
• 저장 조건: OK to freeze; desiccated (hygroscopic); protect from light
• 색상: white
• solubility: DMSO: 2 mg/mL
• 배송 상태: wet ice
• 저장 온도: −20°C

설명

일반 설명

Caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD_82-101 sequence.

생화학적/생리학적 작용

Cell permeable: yes

Primary Target
eNOS

Product does not compete with ATP.

Reversible: no

포장

Packaged under inert gas

경고

Toxicity: Carcinogenic / Teratogenic (D)

서열

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH

물리적 형태

Supplied as a trifluoroacetate salt.

재구성

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

기타 정보

Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem.279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Liu, J., et al. 2002. J. Biol. Chem.277, 10661.
Bucci, M., et al. 2000. Nat. Med.6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem.273, 5419.

법적 정보

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable