추천 제품
분석
>99% (TLC)
양식
powder
포장
pkg of 1 × 10 mg (860381P-10mg)
pkg of 1 × 100 mg (860381P-100mg)
제조업체/상표
Avanti Polar Lipids 860381P
배송 상태
dry ice
저장 온도
−20°C
SMILES string
[H][C@@](COP([O-])(OCC(O)CO)=O)(OC(C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])[2H])=O)COC(C([2H])([2H])C([2H])([2H])C([2H])([2H])
일반 설명
14:0 PG-d54 is a deuterated phosphoglycerol (PG) wherein 54 protons of dimyristoyl are replaced by deuterium.
Deuterated fatty acids experience exchange of the deuteriums on the alpha carbon to the carbonyl, i.e., C2 position, and will therefore be a mixture of compounds that are fully deuterated and partially deuterated at that position.
애플리케이션
14:0 PG-d54 may be used to study the unspecific interaction of a phospholipid membrane with endotoxins.
포장
5 mL Amber Glass Screw Cap Vial (860381P-100mg)
5 mL Amber Glass Screw Cap Vial (860381P-10mg)
Storage Class Code
11 - Combustible Solids
WGK
WGK 3
가장 최신 버전 중 하나를 선택하세요:
Lipopolysaccharide-binding protein-mediated interaction of lipid A from different origin with phospholipid membranes Invited Lecture
Gutsmann T, et al.
Physical Chemistry Chemical Physics, 2(20), 4521-4528 (2000)
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Chris Miranda et al.
Langmuir : the ACS journal of surfaces and colloids, 34(39), 11759-11771 (2018-09-11)
SP-B63-78, a lung surfactant protein fragment, and magainin 2, an antimicrobial peptide, are amphipathic peptides with the same overall charge but different biological functions. Deuterium nuclear magnetic resonance has been used to compare the interactions of these peptides with dispersions
Nicole Harmouche et al.
Biophysical journal, 115(6), 1033-1044 (2018-09-10)
A synergistic enhancement of activities has been described for the amphipathic cationic antimicrobial peptides magainin 2 and PGLa when tested in antimicrobial assays or in biophysical experiments using model membranes. In the presence of magainin 2, PGLa changes from an
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.