HPA018156
Anti-CTSB antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-APP secretase, Anti-APPS, Anti-Cathepsin B precursor, Anti-Cathepsin B1
Sign Into View Organizational & Contract Pricing
All Photos(6)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
immunogen sequence
DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CTSB(1508)
General description
The gene cathepsin B (CTSB) has been mapped to human chromosome 8p22. The gene encodes a lysosomal cysteine protease composed of a dimer of disulphide linked heavy and light chains. Under physiological conditions the protein is localized in lysosomes and in presence of some cellular signals it is released from the lysosomes and trigger different physiological events.
Immunogen
Cathepsin B precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-CTSB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
Cathepsin B (CTSB) has been linked to various responses including lysosomal protein turnover, apoptosis and immune responses. The protein is involved in activation of epithelial Na+ channel in cystic fibrosis lung disease airways. Presence of cocaine along with HIV (human immunodeficiency virus)-1 infection causes increase in CTSB secretion and neurotoxicity. CTSB is up-regulated in synovial fluid of patients suffering with rheumatoid arthritis. The protein is considered as a biomarker for many cancers. Stearoyl-CoA desaturase-5 reduces melanoma malignancy by regulating secretion of CTSB. Mutations in CTSB (C76G/A4383C) have been linked to high risk of hepatocellular carcinoma. CTSB levels and activity were shown to be increased in human esophageal squamous cell carcinoma, breast cancer, colorectal carcinomas and no small cell lung carcinoma. CTSB increase the localization of cytoplasmic c-Jun-NH2-terminus kinase, thereby inducing migration of glioma cells and making them more malignant.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST73333
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
B Werle et al.
Cancer, 89(11), 2282-2291 (2001-01-09)
Tumor cells require specific proteolytic enzymes for invasion and metastasis, including lysosomal peptidases--cathepsins. Cathepsin B is a lysosomal cysteine peptidase, which appears to play a major role in invasion and metastasis of human tumors. In this study, the authors focused
E Campo et al.
The American journal of pathology, 145(2), 301-309 (1994-08-01)
Cathepsin B is a lysosomal cysteine proteinase that has the ability to degrade several extracellular matrix components at both neutral and acidic pH and has been implicated in the progression of several human and rodent tumors. We have studied the
Chong Da Tan et al.
The Journal of physiology, 592(23), 5251-5268 (2014-09-28)
In cystic fibrosis (CF) lung disease, the absence of functional CF transmembrane conductance regulator results in Cl(-)/HCO3 (-) hyposecretion and triggers Na(+) hyperabsorption through the epithelial Na(+) channel (ENaC), which contribute to reduced airway surface liquid (ASL) pH and volume.
Frances Zenón et al.
Journal of neuroimmune pharmacology : the official journal of the Society on NeuroImmune Pharmacology, 9(5), 703-715 (2014-09-12)
Substance abuse is a risk factor for HIV infection and progression to AIDS. Recent evidence establishes that cocaine use promotes brain perivascular macrophage infiltration and microglia activation. The lysosomal protease cathepsin B is increased in monocytes from patients with HIV
He Wang et al.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 26(1), 139-147 (2012-08-25)
The molecular pathogenesis of gastroenteropancreatic neuroendocrine tumors is largely unknown. We hypothesize that gastroenteropancreatic neuroendocrine tumors are heterogeneous with regard to these signaling pathways and these differences could have a significant impact on the outcome of clinical trials. We selected
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service