Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

WH0117156M1

Sigma-Aldrich

Monoclonal Anti-SCGB3A2 antibody produced in mouse

clone 1B2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-LU103, Anti-PNSP1, Anti-UGRP1, Anti-secretoglobin, family 3A, member 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1B2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

In addition to regulating thyroid-specific expression of genes, thyroid transcription factor (TITF1; MIM 600635) controls the transcription of genes specifically expressed in lung, such as surfactant proteins (e.g., SFTPA1; MIM 178630) and uteroglobin (UGB; MIM 192020). Mice lacking Ttf1 die immediately after birth from respiratory failure caused by profoundly hypoplastic lungs (Kimura et al., 1996 [PubMed 8557195]). The UGRP1 gene encodes a uteroglobin-related protein and is a downstream target of TITF1.[supplied by OMIM

Immunogen

SCGB3A2 (AAH24232, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0117156M1-100UG:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Geyon L Garcia et al.
The American journal of pathology, 190(3), 543-553 (2019-12-24)
Chronic obstructive pulmonary disease (COPD) and asthma remain prevalent human lung diseases. Variability in epithelial and inflammatory components that results in pathologic heterogeneity complicates the development of treatments for these diseases. Early childhood infection with parainfluenza virus or respiratory syncytial
Maria R Stupnikov et al.
eLife, 8 (2019-10-22)
Notch signaling regulates cell fate selection during development in multiple organs including the lung. Previous studies on the role of Notch in the lung focused mostly on Notch pathway core components or receptor-specific functions. It is unclear, however, how Jagged
Benjamin J van Soldt et al.
Development (Cambridge, England), 146(9) (2019-04-05)
Although the Hippo-yes-associated protein (Yap) pathway has been implicated in lung development, the specific roles for Yap and its nucleocytoplasmic shuttling in the developing airway and alveolar compartments remain elusive. Moreover, conflicting results from expression studies and differences in the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service