Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

WH0079872M1

Sigma-Aldrich

Monoclonal Anti-CBLL1 antibody produced in mouse

clone 4C2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1, Anti-FLJ23109, Anti-HAKAI, Anti-RNF188

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4C2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

NM_024814

UniProt accession no.

Q75N03

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... CBLL1(79872)

General description

Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex.[supplied by OMIM

Immunogen

CBLL1 (NP_079090, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGE

Biochem/physiol Actions

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 have also been predicted as a regulator of cell proliferation.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0079872M1-100UG:

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Maohong Cao et al.
Journal of molecular histology, 44(2), 135-145 (2012-11-20)
CBLL1 (Casitas B-lineage lymphoma-transforming sequence-like protein 1) also known as Hakai, was originally identified as an E3 ubiquitin-ligase for the E-cadherin complex. Recent data have provided evidences for novel biological functional role of CBLL1 during tumor progression and other diseases.
Maria-Dolores Fernandez-Garcia et al.
Journal of virology, 85(6), 2980-2989 (2010-12-31)
The ubiquitin ligase CBLL1 (also known as HAKAI) has been proposed to be a critical cellular factor exploited by West Nile virus (WNV) for productive infection. CBLL1 has emerged as a major hit in a recent RNA interference screen designed

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service