Skip to Content
Merck
All Photos(1)

Key Documents

Safety Information

WH0009833M1

Sigma-Aldrich

Monoclonal Anti-MELK antibody produced in mouse

clone 4D8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-HPK38, Anti-KIAA0175, Anti-maternal embryonic leucine zipper kinase

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4D8, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MELK(9833)

General description

The maternal embryonic leucine zipper kinase (MELK) is a member of the CAMK serine/threonine protein kinase superfamily. It is expressed at high level in oocytes, spermatogonia and embryos. This gene is mapped to human chromosome 9p13.

Immunogen

MELK (AAH14039, 550 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK

Biochem/physiol Actions

The maternal embryonic leucine zipper kinase (MELK) prevents HIV-1 (human immunodeficiency virus) replication. It participates in cell cycle, cytokinesis, mRNA splicing and apoptosis. MELK also plays an important role in the development of germ cells.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0009833M1-100UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Phosphorylation of the HIV-1 capsid by MELK triggers uncoating to promote viral cDNA synthesis
Takeuchi H, et al.
PLoS Pathogens (2017)
MELK (maternal embryonic leucine zipper kinase)
Tassan JP
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2012)
Identification of IL11RA and MELK amplification in gastric cancer by comprehensive genomic profiling of gastric cancer cell lines
Calcagno DQ, et al.
World Journal of Gastroenterology, 22(43), 9506-9514 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service