WH0006662M2

Monoclonal Anti-SOX9 antibody produced in mouse

clone 3C10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-CMD1, Anti-CMPD1, Anti-SRA1, Anti-SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3C10, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_000346
• UniProt accession no.: P48436
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SOX9(6662)

Description

General description

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. (provided by RefSeq)

Immunogen

SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

Application

Monoclonal Anti-SOX9 antibody produced in mouse has been used in immunofluorescence.

Biochem/physiol Actions

Sex determining region Y-box 9 (SOX9), a transcription factor, is associated with the testis-determining factor sex determining region Y (SRY). It is expressed mainly in adult tissues and also in fetal testis and skeletal tissue. SOX9 consists of two functional domains: a high-mobility group (HMG) DNA-binding domain and a C-terminal transactivation domain. It plays a major role in cartilage differentiation and early testis development. It has been reported that SOX9 might play a role in chondrogenesis. Mutation of SOX9 gene in human causes campomelic dysplasia, a severe dwarfism syndrome and autosomal XY sex reversal.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves