Skip to Content
Merck
All Photos(3)

Key Documents

Safety Information

SAB5201357

Sigma-Aldrich

Monoclonal Anti-Ataxin - Atto 390 antibody produced in mouse

clone S76-8, purified immunoglobulin

Synonym(s):

Anti-ATX1, Anti-D6S504E, Anti-Spinocerebellar ataxia type 1 protein

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

Atto 390 conjugate

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

S76-8, monoclonal

form

buffered aqueous solution

mol wt

antigen predicted mol wt 85 kDa

species reactivity

human, mouse, rat

concentration

1 mg/mL

technique(s)

immunohistochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable

isotype

IgG2b

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

mouse ... Atxn1(20238)

Immunogen

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

SAB5201357-100UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nanoscale organization of nicotinic aceylcholine receptors by stimulated emission depletion microscopy.
Neuroscience, 144(1), 135-143 (2007)
Stimulated emission depletion-based raster image correlation spectroscopy reveals biomolecular dynamics in live cells.
Hedde P.N.; et al.
Nature Communications, 4, 2093-2093 (2013)
Munc18-1 Tuning of Vesicle Merger and Fusion Pore Properties.
Jorgacevski, J.; et al.
The Journal of Neuroscience, 31(24), 9055-9066 (2011)
SNARE Function Is Not Involved in Early Endosome Docking.
Geumann, U.; et al.
Molecular Biology of the Cell, 19(12), 5327-5337 (2008)
STED Nanoscopy in Living Cells Using Fluorogen Activating Proteins.
Fitzpatrick, JA.; et al.
Bioconjugate Chemistry, 20(10), 1843-1847 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service