Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

SAB2102434

Sigma-Aldrich

Anti-TJP1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp686M05161, Anti-MGC133289, Anti-Tight junction protein 1 (zona occludens 1), Anti-ZO-1

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

MDL number:
MFCD00803905
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

187 kDa

species reactivity

rabbit, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

Q07157

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TJP1(7082)

Immunogen

Synthetic peptide directed towards the middle region of human TJP1

Biochem/physiol Actions

TJP1 is a protein located on a cytoplasmic membrane surface of intercellular tight junctions. TJP1 may be involved in signal transduction at cell-cell junctions.This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Two transcript variants encoding distinct isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

recommended

Product No.
Description
Pricing

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

SAB2102434-50UG:
SAB2102434-100UL:

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sumei Sha et al.
Inflammation research : official journal of the European Histamine Research Society ... [et al.], 63(10), 873-883 (2014-08-15)
To analyze the in vivo effect of Escherichia coli Nissle 1917 (EcN) with different courses and different doses to Sprague-Dawley rats with trinitrobenzene sulfonic acid (TNBS)-induced colitis. The probiotic was orally administered with different courses of treatment (with or without
Leopoldina Scotti et al.
Molecular reproduction and development, 81(8), 748-756 (2014-06-04)
Polycystic ovary syndrome (PCOS) is the most common endocrinological pathology among women of reproductive age, and is characterized by abnormalities in ovarian angiogenesis, among other features. Consistent with this association, follicular fluid (FF) concentration and ovarian expression of vascular endothelial
Mylene Nébot-Vivinus et al.
World journal of gastroenterology, 20(22), 6832-6843 (2014-06-20)
To investigate the effect of the probiotic combination Lactibiane Tolerance(®) (LT) on epithelial barrier function in vitro and in vivo. The effect of the multispecies probiotic LT was assessed on several models of epithelial barrier function both in vitro (in
Ying Li et al.
ORL; journal for oto-rhino-laryngology and its related specialties, 76(2), 110-119 (2014-05-08)
To evaluate the expression of five epithelial intercellular junctional proteins in the sinonasal tissue of subjects with chronic rhinosinusitis (CRS). Forty-one samples of nasal polyp tissue of CRS patients with nasal polyps (wNP), 20 ethmoid sinus mucosa of CRS patients
Jeffrey H Boatright et al.
Molecular vision, 21, 40-60 (2015-01-17)
Our goal was to optimize procedures for assessing shapes, sizes, and other quantitative metrics of retinal pigment epithelium (RPE) cells and contact- and noncontact-mediated cell-to-cell interactions across a large series of flatmount RPE images. The two principal methodological advances of
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service