Skip to Content
Merck
All Photos(9)

Key Documents

Safety Information

HPA023030

Sigma-Aldrich

Anti-SLFN11 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Schlafen family member 11

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLFN11(91607)

General description

SLFN proteins are found exclusively in mammals.
SLFN11 (schlafen family member 11) protein contains a putative AAA (ATPases associated with diverse cellular activities) domain. The gene is mapped to human chromosome 17q12.

Immunogen

Schlafen family member 11 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SLFN11 antibody produced in rabbit has been used for immunohistochemistry study.

Biochem/physiol Actions

SLFN proteins play a vital role in regulation of various biological functions such as cell-cycle arrest, differentiation, and cancer cell invasion. SLFN11 also acts as a dominant response factor of cancer cells to topoisomerase I inhibitors.
Schlafen (SLFN) genes are part of interferon-stimulated early response genes and are activated in the presence of pathogens by IRF3 (interferon regulatory factor 3) pathway. SLFN11 inhibits the generation of retroviruses, including human immunodeficiency virus 1 (HIV-1). It stops the production of viral proteins via codon-bias discrimination method. It also makes cancer cells sensitive to DNA-damaging agents.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75872

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA023030-25UL:
HPA023030-100UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

SLFN11 is a transcriptional target of EWS-FLI1 and a determinant of drug response in Ewing sarcoma
Tang SW, et al.
Clinical Cancer Research, 21(18), 4184-4193 (2015)
Genetic variation in schlafen genes in a patient with a recapitulation of the murine Elektra phenotype.
Mike Recher et al.
The Journal of allergy and clinical immunology, 133(5), 1462-1465 (2014-01-01)
Lauren Averett Byers et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 27(14), 3884-3895 (2021-05-06)
This study investigated the efficacy and safety of oral PARP inhibitor veliparib, plus carboplatin and etoposide in patients with treatment-naïve, extensive-stage small cell lung cancer (ED-SCLC). Patients were randomized 1:1:1 to veliparib [240 mg twice daily (BID) for 14 days]
PARP Inhibitor Activity Correlates with SLFN11 Expression and Demonstrates Synergy with Temozolomide in Small Cell Lung Cancer.
Lok BH, et al.
Clinical Cancer Research, 23, 523-535 (2017)
Benjamin H Lok et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 23(2), 523-535 (2016-07-22)
PARP inhibitors (PARPi) are a novel class of small molecule therapeutics for small cell lung cancer (SCLC). Identification of predictors of response would advance our understanding, and guide clinical application, of this therapeutic strategy. Efficacy of PARP inhibitors olaparib, rucaparib

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service