HPA000243

Anti-OTC antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-OTCase, Anti-Ornithine carbamoyltransferase, mitochondrial precursor, Anti-Ornithine transcarbamylase
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA000243
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:2500-1:5000
• immunogen sequence: ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT
• UniProt accession no.: P00480
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... OTC(5009)

Description

General description

Ornithine transcarbamylase (OTC) is mapped to human chromosome Xp11.4 It is expressed in hepatocytes and enterocytes and belongs to the transcarbamylase family. Its precursor possesses a N-terminal signal peptide. OTC exists as anabolic and catabolic forms. Structurally, OTC comprises two lobes with the substrate carbamoyl phosphate (CP) binding pocket in between them. The conserved Ser-Thr-Arg-Thr-Arg motif is essential for CP binding.

Immunogen

Ornithine carbamoyltransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-OTC antibody produced in rabbit has been used in:

• western blotting
• immunofluorescence
• immunohistochemical staining

Biochem/physiol Actions

Ornithine transcarbamylase (OTC), a urea cycle enzyme, catalyzes the conversion carbamoyl phosphate and ornithine to citrulline. It is a key enzyme for ammonia synthesis as well as for the catabolism of amino acids. The active site lysine 88 residue is crucial for binding carbamoyl phosphate. The anabolic OTC is involved in the urea cycle and arginine biosynthesis. The catabolic OTC participates in the arginine deiminase pathway and citrulline breakdown. A deficiency in OTC leads to urea cycle disruption resulting in ornithine transcarbamylase disorder (OTCD).

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74006

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves