Skip to Content
Merck
All Photos(2)

Key Documents

Safety Information

AV54569

Sigma-Aldrich

Anti-EPB41L2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Erythrocyte membrane protein band 4.1-like 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

66 kDa

species reactivity

dog, rabbit, rat, bovine, horse, human, guinea pig, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EPB41L2(2037)

General description

The gene EPB41L2 maps to human chromosome 6q23 and is widely expressed among human tissues. The gene encodes a 113-kDa protein that exhibits three regions of high homology to EPB41, including the membrane binding domain, the spectrin–actin binding domain, and the C-terminal domain.

Immunogen

Synthetic peptide directed towards the middle region of human EPB41L2

Application

Anti-EPB41L2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

The protein encoded by this gene interacts with the C-terminus of G protein-coupled receptors (GPCRs) and regulates intracellular distribution of the receptors, including parathyroid hormone.

Sequence

Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV54569-100UL:
AV54569-50UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

M K Adwankar et al.
Neoplasma, 37(1), 31-36 (1990-01-01)
P388 mouse lymphocytic leukemia cells sensitive (P388/S) and resistant to adriamycin (P388/Adr), respectively, were exposed in vitro to 3 dose concentrations of adriamycin, mitoxantrone, vincristine and cisplatin in the presence and absence of extracellular Ca++ at 37 degrees C for
M Parra et al.
Genomics, 49(2), 298-306 (1998-05-23)
The prototypical erythrocyte membrane skeletal protein 4.1 (HGMW-approved symbol EPB41), here designated 4.1R, is encoded by a large, complexly spliced gene located on human chromosome 1p32-p33. In this paper we report evidence for a second 4.1 gene, 4.1G (HGMW-approved symbol

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service